GpgleResults 1 - 10 of about 1,460 for gpgle. 0.28 seconds Did you mean: googleGpgle.deGpgle.de. Related Searches : Cheap Flights Dating Music Downloads.gpgle.de/ - 4k - - Query Name: The following table shows the The following table shows the authoritative Nameservers for that may be poisoning DNS caches. Replies from these nameservers contain bogus dns.measurement-factory.com/ cgi-bin/poison_browser.pl?qn= - 3k - Supplemental Result - - PDF <GHCLDM 9DAMNKD s:0+ <GHCLDM =DPL LLND R 7DB 1001File Format: PDF/Adobe Acrobat - View as HTMLYour browser may not have a PDF reader available. Google recommends visiting our text version of this document.GPGLE -OMRN X QM O?GPC DRLBP DMO KCLQ?J FC?JQF OCJ?QCB GPGLE CDDMOQP MD QFC 0?OBGLC 3?QFCPML -OMRN BROGLE qoopnqooq. F?SC @CCL ? - google,gogke,goggle,goole,ggle,goglee,goglle,gggle,oogle,gogl - Translate this page google,gogke,goggle,goole,ggle,goglee,goglle,gggle,oogle,gogl,hogle,ggogle,gpgle, golge,golle,goge,goglr,gohle,ogle,ggole,gogge,gigle,gofle,gole,oggle,fogle typotool/queries.html?Query:inccount=55104001144914676 - 112k - Supplemental Result - - Pdb blast alignment data for MP protein A002860 - Signaling Gateway Positives = 58/86 67% Query: 1352 RVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIP 1411 +VRA GPGLE F++ TR AG GGL +A+EGPS+A++S +D KDGSC V queryjsessionid=c6ca4bf1229ca1eb8540d37c4bc6b235f22ce6248408?afcsid=A - 21k - Supplemental Result - - Pdb blast alignment data for MP protein A000162 - Signaling Gateway Gaps = 2/115 1% Query: 2155 VKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFGIWTREAGAGGLAI 2214 VYG VPGSP+ TV KV+A GPGLE G PAEF I T+ AG GGL + Sbjct: 9 queryjsessionid=c6ca4bf1229c4bce58828cc6469bb36ea979f6eb82de?afcsid=A - 25k - Supplemental Result - - More results from Gpgle.es - Translate this page Google. Aviso Legal. - 3k - - ESTree: blast output page 212 Query: 492 VTR--GNVGDYFVGPGLEELFEQLSAND--RRGPPPASRVSIDAMPTIKITNRHLRSD-S 656 R GN GDYF GPGLE+L +QL+ ND R G PPAS+ +IDA+PT+K+T L+S+ + Sbjct: 213 - 26k - - |
|